bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_6255_orf1 Length=100 Score E Sequences producing significant alignments: (Bits) Value Hs18378735 28.9 2.1 SPBC30D10.08 28.1 4.4 7299111 27.7 5.6 > Hs18378735 Length=3117 Score = 28.9 bits (63), Expect = 2.1, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 0/33 (0%) Query 29 LSIWPFSVSVCDNVRAVTKSECSPDRRFLRRAG 61 L + P S +VCD+V KS S R+ R+ G Sbjct 48 LEVAPTSTAVCDSVMDTKKSSTSATRKISRKDG 80 > SPBC30D10.08 Length=267 Score = 28.1 bits (61), Expect = 4.4, Method: Compositional matrix adjust. Identities = 20/51 (39%), Positives = 23/51 (45%), Gaps = 13/51 (25%) Query 28 GLSIWPFSVSVCDNVRA---VTKSECSPD----------RRFLRRAGGPSG 65 GLS PFS +CD + A V E PD RR L +A GP G Sbjct 103 GLSSQPFSKEICDLLTAPLEVDDIEIKPDGILYLPEIKYRRILNKAFGPGG 153 > 7299111 Length=587 Score = 27.7 bits (60), Expect = 5.6, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 0/39 (0%) Query 27 KGLSIWPFSVSVCDNVRAVTKSECSPDRRFLRRAGGPSG 65 KG P S S C+ + A T S CSP + P+G Sbjct 365 KGDPQAPTSTSYCNELAAATSSSCSPPGSVVSTTDNPNG 403 Lambda K H 0.322 0.137 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1187882580 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40