bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_6148_orf1 Length=63 Score E Sequences producing significant alignments: (Bits) Value Hs7662000_2 27.3 7.9 Hs22044241 26.9 9.8 > Hs7662000_2 Length=756 Score = 27.3 bits (59), Expect = 7.9, Method: Compositional matrix adjust. Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 6/42 (14%) Query 24 CPHTRMSMPSHSHAESFC--KCGVLVCSAWFEVFFSVNGKHY 63 C H R+ H+H +C +CGVL SA+F+ N HY Sbjct 245 CAHQRI----HAHKSPYCCPECGVLCRSAYFQTHVKENCLHY 282 > Hs22044241 Length=346 Score = 26.9 bits (58), Expect = 9.8, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 20/38 (52%), Gaps = 0/38 (0%) Query 23 QCPHTRMSMPSHSHAESFCKCGVLVCSAWFEVFFSVNG 60 Q + +S+P + E F G ++CS F ++F NG Sbjct 100 QAKYRLLSLPVSNTPEHFDPAGTMLCSPLFLLYFLRNG 137 Lambda K H 0.328 0.131 0.454 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1172754882 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40