bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_6147_orf2 Length=56 Score E Sequences producing significant alignments: (Bits) Value HsM6912746 29.3 1.7 At5g10450 27.7 6.0 Hs21464101 27.3 6.3 ECU03g1010 27.3 7.5 > HsM6912746 Length=247 Score = 29.3 bits (64), Expect = 1.7, Method: Compositional matrix adjust. Identities = 11/35 (31%), Positives = 22/35 (62%), Gaps = 0/35 (0%) Query 13 LKMGLVLNYAVLLHDEPDGAEQAINALAAQFREAV 47 +++GL LNY+V ++ + EQA + +F +A+ Sbjct 169 IRLGLALNYSVFYYEIQNAPEQACHLAKTEFEDAI 203 > At5g10450 Length=273 Score = 27.7 bits (60), Expect = 6.0, Method: Compositional matrix adjust. Identities = 10/35 (28%), Positives = 22/35 (62%), Gaps = 0/35 (0%) Query 13 LKMGLVLNYAVLLHDEPDGAEQAINALAAQFREAV 47 +++GL LN++V ++ + +++A N F EA+ Sbjct 175 IRLGLALNFSVFYYEILNSSDKACNMAKQAFEEAI 209 > Hs21464101 Length=247 Score = 27.3 bits (59), Expect = 6.3, Method: Compositional matrix adjust. Identities = 11/35 (31%), Positives = 21/35 (60%), Gaps = 0/35 (0%) Query 13 LKMGLVLNYAVLLHDEPDGAEQAINALAAQFREAV 47 +++GL LNY+V ++ + EQA + F +A+ Sbjct 171 IRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAI 205 > ECU03g1010 Length=258 Score = 27.3 bits (59), Expect = 7.5, Method: Composition-based stats. Identities = 13/43 (30%), Positives = 27/43 (62%), Gaps = 0/43 (0%) Query 13 LKMGLVLNYAVLLHDEPDGAEQAINALAAQFREAVENVVHISD 55 +K+GL LNY+V ++ + +E+A + F EA++ + +S+ Sbjct 176 IKLGLALNYSVFHYEILNDSEKACSIAKGAFDEAIKELDTLSE 218 Lambda K H 0.313 0.130 0.348 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1194096762 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40