bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_5722_orf1 Length=107 Score E Sequences producing significant alignments: (Bits) Value CE27773 31.2 0.49 CE15911 28.5 2.9 CE03158 28.5 3.3 CE27138 28.1 3.6 7304217 27.7 5.5 Hs14739523 26.9 8.6 Hs17482471 26.9 9.2 > CE27773 Length=4063 Score = 31.2 bits (69), Expect = 0.49, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 0/31 (0%) Query 33 TRTPLDATRHRLLLRRLHSRGCMLETSTHHH 63 TR+ RH LLL+ + RG MLE S +H Sbjct 2701 TRSEEVTARHALLLKSMEKRGHMLEDSKKYH 2731 > CE15911 Length=739 Score = 28.5 bits (62), Expect = 2.9, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 0/31 (0%) Query 29 SGSGTRTPLDATRHRLLLRRLHSRGCMLETS 59 + G R AT LR +HS GC+L+T+ Sbjct 534 TSDGFRLTFGATEREQFLRIMHSLGCLLDTA 564 > CE03158 Length=452 Score = 28.5 bits (62), Expect = 3.3, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Query 15 FQISKRPKKGWG-GGSGSGTRTPLDATRHRLLLRRLHSRGCMLETSTHHHL 64 F + + W GG G G +PL +H L ++L +R STH+ L Sbjct 53 FNVDPFQEDSWTFGGGGWGQLSPLGMNQHLTLGKKLRNRYVNTGNSTHNFL 103 > CE27138 Length=720 Score = 28.1 bits (61), Expect = 3.6, Method: Composition-based stats. Identities = 10/13 (76%), Positives = 11/13 (84%), Gaps = 0/13 (0%) Query 94 RCSACSSFHSGSC 106 RCSACSSF +G C Sbjct 93 RCSACSSFRNGPC 105 > 7304217 Length=565 Score = 27.7 bits (60), Expect = 5.5, Method: Composition-based stats. Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 0/25 (0%) Query 24 GWGGGSGSGTRTPLDATRHRLLLRR 48 GWGG +GS L+A R +L R+ Sbjct 68 GWGGNNGSTLTAALEANRRQLKWRK 92 > Hs14739523 Length=467 Score = 26.9 bits (58), Expect = 8.6, Method: Compositional matrix adjust. Identities = 22/54 (40%), Positives = 26/54 (48%), Gaps = 11/54 (20%) Query 21 PKKGWGGGSGSGTRTPLDA-TR----HRLLLRRLHSRGC------MLETSTHHH 63 P G GGGSG RTPLD TR HR + L +GC +E +HH Sbjct 226 PAPGLGGGSGPRQRTPLDILTRVFPGHRRGVLELVLQGCGGDVVQAIEQVLNHH 279 > Hs17482471 Length=410 Score = 26.9 bits (58), Expect = 9.2, Method: Composition-based stats. Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Query 35 TPLDATRHRLLLRRLH--SRGCMLETSTHHHLANTEQI 70 T LD TRH L +R +H G L + H L T+++ Sbjct 238 TALDTTRHELPVRSIHLEGDGQQLLDALQHELVTTQRL 275 Lambda K H 0.325 0.136 0.468 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1164169380 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40