bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_5513_orf1 Length=100 Score E Sequences producing significant alignments: (Bits) Value 7297375 31.2 0.50 CE17732 29.6 1.5 At1g78770 28.9 2.5 Hs7662342 27.3 7.0 > 7297375 Length=326 Score = 31.2 bits (69), Expect = 0.50, Method: Composition-based stats. Identities = 10/37 (27%), Positives = 19/37 (51%), Gaps = 0/37 (0%) Query 36 VFNCVESFYAPLRYIRKVFWWAPHNKKCTRAVSHRLY 72 ++ C+ Y P+R R +F W N+ ++H+ Y Sbjct 271 MYFCIADLYMPVRIWRLIFLWVASNQTINALLTHKWY 307 > CE17732 Length=2025 Score = 29.6 bits (65), Expect = 1.5, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 19/40 (47%), Gaps = 0/40 (0%) Query 51 RKVFWWAPHNKKCTRAVSHRLYDACKARPPLRGSMSAHNF 90 RKV+ W+ H+ CT + +RPP GS S F Sbjct 1214 RKVYSWSTHHMTCTWWATQIHVYGETSRPPTDGSPSEDTF 1253 > At1g78770 Length=521 Score = 28.9 bits (63), Expect = 2.5, Method: Composition-based stats. Identities = 11/35 (31%), Positives = 18/35 (51%), Gaps = 0/35 (0%) Query 42 SFYAPLRYIRKVFWWAPHNKKCTRAVSHRLYDACK 76 +F A + Y K W P ++ CT ++ L D C+ Sbjct 477 NFSAAISYYHKALWLKPDDQFCTEMLNVALMDECQ 511 > Hs7662342 Length=837 Score = 27.3 bits (59), Expect = 7.0, Method: Composition-based stats. Identities = 14/52 (26%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Query 18 VALGEASFVPGRIKNDFPVFNCVESFYAPLRYIRKVFWWAPHNKKCTRAVSH 69 +A +ASF+ + +D V+ +E I+K W++ H +C R + H Sbjct 451 IAHLKASFLQSQFPDDAEVYRLIEVTGLARSEIKK--WFSDHRYRCQRGIVH 500 Lambda K H 0.328 0.137 0.467 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1187882580 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40