bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_5425_orf8 Length=52 Score E Sequences producing significant alignments: (Bits) Value Hs4758742 29.6 1.5 Hs7705694 29.6 1.6 > Hs4758742 Length=299 Score = 29.6 bits (65), Expect = 1.5, Method: Composition-based stats. Identities = 11/27 (40%), Positives = 18/27 (66%), Gaps = 0/27 (0%) Query 15 VIRQLQTGIPEVVHDTAFPTGVTTFAP 41 + +QL+ +P VV+ +AFP+G T P Sbjct 64 ITQQLEGALPSVVNGSAFPSGSTLPGP 90 > Hs7705694 Length=341 Score = 29.6 bits (65), Expect = 1.6, Method: Compositional matrix adjust. Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 5/44 (11%) Query 1 SAVEAVLRSRERSKVIRQLQTGIPEVVHDTAFPTGVTTFAPHAR 44 SA +A+ R+ +Q Q+G P ++ DTAF GV F P A+ Sbjct 141 SAADAI----NRNSTGQQSQSGSPCIMDDTAFNRGVNAF-PEAK 179 Lambda K H 0.322 0.133 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1158678716 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40