bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_5425_orf5 Length=60 Score E Sequences producing significant alignments: (Bits) Value Hs14149677_3 31.2 0.47 CE08567 28.9 2.3 7301272 28.5 3.0 Hs6912464_3 27.7 5.3 > Hs14149677_3 Length=760 Score = 31.2 bits (69), Expect = 0.47, Method: Composition-based stats. Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 2/48 (4%) Query 6 LCHVRLQGSQFAAVELLLSALCSVGLLLLLTTLILCTFSHC-LQGLSA 52 + HV ++ S A +LLL + VG+LL L L++C F+ C +GL + Sbjct 381 MAHVEVKHSD-AVHDLLLDVITWVGILLSLVCLLICIFTFCFFRGLQS 427 > CE08567 Length=493 Score = 28.9 bits (63), Expect = 2.3, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 18/26 (69%), Gaps = 0/26 (0%) Query 31 LLLLLTTLILCTFSHCLQGLSAPPTP 56 +L+++ L LC F++ L+GL PTP Sbjct 8 ILVIIVMLFLCRFANKLRGLPPGPTP 33 > 7301272 Length=917 Score = 28.5 bits (62), Expect = 3.0, Method: Composition-based stats. Identities = 9/11 (81%), Positives = 10/11 (90%), Gaps = 0/11 (0%) Query 49 GLSAPPTPPVP 59 GLS PPTPP+P Sbjct 867 GLSVPPTPPIP 877 > Hs6912464_3 Length=955 Score = 27.7 bits (60), Expect = 5.3, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query 20 ELLLSALCSVGLLLLLTTLILCTFSHC-LQGLSA 52 ELLL+ + VG+++ L L +C F+ C +GL + Sbjct 383 ELLLTVITWVGIVISLVCLAICIFTFCFFRGLQS 416 Lambda K H 0.327 0.140 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1181901402 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40