bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_5396_orf5 Length=50 Score E Sequences producing significant alignments: (Bits) Value SPAC6F12.09 29.6 1.5 Hs21314753 29.3 1.8 HsM14150225 29.3 1.9 At2g45960 28.1 4.6 > SPAC6F12.09 Length=1215 Score = 29.6 bits (65), Expect = 1.5, Method: Composition-based stats. Identities = 11/36 (30%), Positives = 21/36 (58%), Gaps = 0/36 (0%) Query 2 GQVSTLKENKPKGGRSNPEEMIDIAGPVPMPFLEPS 37 G + +K N+P G+++ ++ A P +PF EP+ Sbjct 101 GTIEFMKINEPLNGQTSTTAIVQFAPPPKVPFWEPN 136 > Hs21314753 Length=293 Score = 29.3 bits (64), Expect = 1.8, Method: Compositional matrix adjust. Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 5/48 (10%) Query 2 GQVSTLKENKPKGGRSNPEEMIDIAGPVPM---PFLE--PSRIASGND 44 GQV K+ K G PE+ +D GP P+ FLE S++A ND Sbjct 207 GQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELND 254 > HsM14150225 Length=293 Score = 29.3 bits (64), Expect = 1.9, Method: Compositional matrix adjust. Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 5/48 (10%) Query 2 GQVSTLKENKPKGGRSNPEEMIDIAGPVPM---PFLE--PSRIASGND 44 GQV K+ K G PE+ +D GP P+ FLE S++A ND Sbjct 207 GQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELND 254 > At2g45960 Length=286 Score = 28.1 bits (61), Expect = 4.6, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Query 9 ENKPKGGRSNPEEMIDIAGPVPMPFLEPSRIASGNDWRS 47 E +P G + ++ D P P P EP +AS + WR+ Sbjct 17 ERQPIGTSAQSDK--DYKEPPPAPLFEPGELASWSFWRA 53 Lambda K H 0.309 0.130 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1164550556 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40