bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_5365_orf1 Length=131 Score E Sequences producing significant alignments: (Bits) Value SPCC1672.08c 30.8 0.66 At2g33610 30.4 0.82 At1g50150 30.4 0.91 ECU06g0350 30.4 1.0 CE21216 28.1 4.3 > SPCC1672.08c Length=285 Score = 30.8 bits (68), Expect = 0.66, Method: Compositional matrix adjust. Identities = 21/73 (28%), Positives = 35/73 (47%), Gaps = 13/73 (17%) Query 46 IDKEVKQLWDEVELPPLEAILLHFNSANLLTQQKPEAGTNNQAKQRG-----QEKRQRTR 100 +DKE +Q+W E+ +PP + L KP + + K+ G ++K+ +TR Sbjct 210 VDKEFQQVWHEIPIPPTLDLASELGKYGL----KPTSVDPSTVKRAGHNQTPKQKKPKTR 265 Query 101 HLNKFRRIQNTHL 113 +I NTHL Sbjct 266 R----GKITNTHL 274 > At2g33610 Length=432 Score = 30.4 bits (67), Expect = 0.82, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 4/59 (6%) Query 11 CDLYDKKKCSNCYKNICCLILYPTGDAAAEDSRFKIDKEVKQLWDEVELPPLEAILLHF 69 CD YD C+ CY Y G ++E R +I +E K W + E+ L ++H+ Sbjct 189 CDKYDLTLCARCYVRSN----YRVGINSSEFKRVEISEESKPEWSDKEILLLLEAVMHY 243 > At1g50150 Length=358 Score = 30.4 bits (67), Expect = 0.91, Method: Compositional matrix adjust. Identities = 26/79 (32%), Positives = 41/79 (51%), Gaps = 8/79 (10%) Query 35 GDAAAEDSRFKIDKEVKQLWDEVELPPLEAILLHFNSANLLTQQKPEAGTNNQAKQRGQE 94 G+ A+EDSRF ++K+ ++ E +E HF+S L Q NN+ +R E Sbjct 71 GNNASEDSRFPLNKD--KMGKEKSTVGVE----HFDSHAQLGVQDQIEWLNNE--KRASE 122 Query 95 KRQRTRHLNKFRRIQNTHL 113 R+ + LNK R++N L Sbjct 123 SRKESPFLNKRERLKNEFL 141 > ECU06g0350 Length=247 Score = 30.4 bits (67), Expect = 1.0, Method: Compositional matrix adjust. Identities = 19/72 (26%), Positives = 35/72 (48%), Gaps = 6/72 (8%) Query 46 IDKEVKQLWDEVELPPLEAILLHFNSANLLTQQKPEAGTNNQAKQRGQEKRQRTRHLNKF 105 +D ++K LW++V + ++ N+A L T++ K+R K ++ R + Sbjct 174 VDPQIKSLWNQVRITTYHDLIRELNTAGLKTEKV------ENVKKRPTIKIKKDRRSRRK 227 Query 106 RRIQNTHLFTAD 117 RI NTH+ D Sbjct 228 IRITNTHVKGLD 239 > CE21216 Length=2331 Score = 28.1 bits (61), Expect = 4.3, Method: Composition-based stats. Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 5/83 (6%) Query 37 AAAEDSRFKIDKEVKQLWDEV-ELPPLEAILLHFNSANLLTQQKPEAGTNNQAKQRGQEK 95 A E+ + ++++ VK+L D+V EL +E HF A LL A T N +K EK Sbjct 1472 AKIEEEKEQLEQHVKELEDQVAEL--MEQHETHFRQAQLLQSATSSANTENISKVHDSEK 1529 Query 96 RQRTRHLNKFRRIQNTHLFTADE 118 + L+ +I N + ++ Sbjct 1530 --EVQRLSAIEKILNNRILALED 1550 Lambda K H 0.317 0.132 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1283105810 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40