bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_5307_orf3 Length=77 Score E Sequences producing significant alignments: (Bits) Value Hs20127580 28.5 3.1 At4g35790 28.1 4.3 At2g37920_1 27.7 4.7 > Hs20127580 Length=525 Score = 28.5 bits (62), Expect = 3.1, Method: Composition-based stats. Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 3/66 (4%) Query 8 LLFEVSPFPRVRSLFRPRLLTKSFLWSVS-FRVRVSGW-VSPSESRLRDSLSVS-FIVQF 64 L F V+P PRV + RPR + S++ F+ S W S + R+R S++ F+V F Sbjct 347 LHFTVNPKPRVEFIDRPRCCLRGKECSINRFQQVESRWGYSGTSDRIRFSVNKRIFVVGF 406 Query 65 VLFESV 70 L+ S+ Sbjct 407 GLYGSI 412 > At4g35790 Length=1071 Score = 28.1 bits (61), Expect = 4.3, Method: Composition-based stats. Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 0/41 (0%) Query 19 RSLFRPRLLTKSFLWSVSFRVRVSGWVSPSESRLRDSLSVS 59 R + R LTK+ + SVS VS ++ S R RDS S S Sbjct 874 RLILRFIALTKTLILSVSIATSVSSAMADSPQRRRDSRSPS 914 > At2g37920_1 Length=185 Score = 27.7 bits (60), Expect = 4.7, Method: Compositional matrix adjust. Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Query 23 RPRLLTKSFLWSVSFRVRVSGWVSPSESRLRDSLSVSFI 61 RP LL +F W + +V SGW P R +L++ F+ Sbjct 26 RPSLLHPTFYWGYNCQVLFSGW--PGSDRGMYALALIFV 62 Lambda K H 0.332 0.141 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1175087368 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40