bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_5307_orf1 Length=98 Score E Sequences producing significant alignments: (Bits) Value Hs5902104 28.5 3.4 Hs19923502 28.1 4.0 CE18028 28.1 4.3 YGR041w 27.3 6.8 At4g17330_1 27.3 7.0 > Hs5902104 Length=466 Score = 28.5 bits (62), Expect = 3.4, Method: Composition-based stats. Identities = 24/82 (29%), Positives = 35/82 (42%), Gaps = 2/82 (2%) Query 2 MKETLNESRRRLSEGDTQP--ETRTRKETLHKKDLVKRRGRNRDRTLGKGDTSKRRHLKK 59 + +TL + R L+E D +P E R HKKD + + R R GK + Sbjct 134 LSKTLGKLWRLLNESDKRPFIEEAERLRMQHKKDHPDYKYQPRRRKNGKAAQGEAECPGG 193 Query 60 ETLQKGDTSKRRHFKKETLQRR 81 E Q G + + H+K L R Sbjct 194 EAEQGGTAAIQAHYKSAHLDHR 215 > Hs19923502 Length=490 Score = 28.1 bits (61), Expect = 4.0, Method: Compositional matrix adjust. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 0/34 (0%) Query 34 LVKRRGRNRDRTLGKGDTSKRRHLKKETLQKGDT 67 LV R GR+ +RT+ G S + KK L G T Sbjct 417 LVSRTGRHSERTVSAGKGSATSNWKKTPLSTGGT 450 > CE18028 Length=347 Score = 28.1 bits (61), Expect = 4.3, Method: Composition-based stats. Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 5/45 (11%) Query 3 KETLNESRRRLSEGDTQPET-----RTRKETLHKKDLVKRRGRNR 42 +E LNE R LS+G TQ T R + E L ++D RR R Sbjct 290 EENLNEVREELSKGKTQHSTSGTSLRLKYEKLIEEDGAIRRALQR 334 > YGR041w Length=547 Score = 27.3 bits (59), Expect = 6.8, Method: Compositional matrix adjust. Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 0/50 (0%) Query 29 LHKKDLVKRRGRNRDRTLGKGDTSKRRHLKKETLQKGDTSKRRHFKKETL 78 LH+K+ +GKGD S ++H K+ Q+ D ++ F+ ET+ Sbjct 383 LHEKEYESNIEAGLASGVGKGDNSIKQHQYKKIPQEIDRDQQLSFQMETM 432 > At4g17330_1 Length=912 Score = 27.3 bits (59), Expect = 7.0, Method: Composition-based stats. Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 0/44 (0%) Query 42 RDRTLGKGDTSKRRHLKKETLQKGDTSKRRHFKKETLQRRAQNP 85 R+ T+ K DTS ET++ G TS R KE NP Sbjct 121 REDTIKKSDTSHELGCTMETVEPGQTSHERSLSKEETVNLQPNP 164 Lambda K H 0.312 0.128 0.355 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1194657780 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40