bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_5294_orf3 Length=65 Score E Sequences producing significant alignments: (Bits) Value YPL164c 29.3 1.9 SPCC320.05 26.9 8.5 > YPL164c Length=715 Score = 29.3 bits (64), Expect = 1.9, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 5/40 (12%) Query 11 VMRDFVAC-----LDLFMFILLTSVNTDTFVRRDARFCCM 45 V+ D AC L+ + LLT V T TFV RD + CC+ Sbjct 520 VLVDQHACDERIRLEELFYSLLTEVVTGTFVARDLKDCCI 559 > SPCC320.05 Length=667 Score = 26.9 bits (58), Expect = 8.5, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 22/36 (61%), Gaps = 0/36 (0%) Query 4 TQTLLSGVMRDFVACLDLFMFILLTSVNTDTFVRRD 39 TQ+L +GVM F+A +D + + S+ T+ +R + Sbjct 330 TQSLQTGVMCSFLAFIDTVIAVKAISLQTNNLIRSN 365 Lambda K H 0.339 0.143 0.474 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1166657202 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40