bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_5218_orf3 Length=92 Score E Sequences producing significant alignments: (Bits) Value CE20434 29.3 1.7 SPAC212.08c 28.9 2.4 Hs17978479 28.9 2.6 Hs17978481 28.5 2.8 CE13301 28.1 3.6 YBR083w 27.3 6.4 > CE20434 Length=416 Score = 29.3 bits (64), Expect = 1.7, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 5/55 (9%) Query 11 PLESLLGVTDGKPHLTLPWNNQTRLLCVAHDGVEWFLVDAETLRPVCLGIYETKY 65 PLE+ L + + KP + W + +H W + L P+ G+Y TKY Sbjct 307 PLETYLLLNELKPEIN-GWKYINLVFFFSH----WLAMSNSCLNPIIYGLYNTKY 356 > SPAC212.08c Length=278 Score = 28.9 bits (63), Expect = 2.4, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 0/40 (0%) Query 19 TDGKPHLTLPWNNQTRLLCVAHDGVEWFLVDAETLRPVCL 58 T G LT P ++ L C G ++F + ETLRP L Sbjct 93 TLGGTFLTSPTAKRSNLYCDDFTGADYFSCELETLRPYTL 132 > Hs17978479 Length=839 Score = 28.9 bits (63), Expect = 2.6, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Query 9 GEPLESLLGVTDGKPHLTLPWNNQTRLLCVAHDG 42 G PL SLL + P ++L W+ + LLCV DG Sbjct 73 GMPLASLLWKSG--PVVSLGWSAEEELLCVQEDG 104 > Hs17978481 Length=695 Score = 28.5 bits (62), Expect = 2.8, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Query 9 GEPLESLLGVTDGKPHLTLPWNNQTRLLCVAHDG 42 G PL SLL + P ++L W+ + LLCV DG Sbjct 73 GMPLASLLWKSG--PVVSLGWSAEEELLCVQEDG 104 > CE13301 Length=441 Score = 28.1 bits (61), Expect = 3.6, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query 13 ESLLGVTDGKPHLTLPWNNQTRLLCVAHDGVE 44 E L+GV DGKP++T P+ + R+ DG E Sbjct 333 EMLMGVKDGKPNIT-PFLKKARIFYRLSDGAE 363 > YBR083w Length=486 Score = 27.3 bits (59), Expect = 6.4, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 19/32 (59%), Gaps = 0/32 (0%) Query 61 YETKYICQNVHINVPNYERIPRKRSFVPARRS 92 Y+T Y Q + + +YE P +R+F P+ +S Sbjct 450 YQTSYFSQLLLSSPQHYEHSPHQRNFTPSNQS 481 Lambda K H 0.321 0.140 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1171209254 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40