bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_5218_orf1 Length=94 Score E Sequences producing significant alignments: (Bits) Value CE06735 28.9 2.1 7295029 28.5 2.9 Hs21040235 28.5 3.2 > CE06735 Length=552 Score = 28.9 bits (63), Expect = 2.1, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 3/58 (5%) Query 11 LRLAFSWSSPCPGISTLTSTPPRWYEAPL---SRNSLIIWYINVNILTYVLSLIYTQT 65 +R A + C S+ T +P +W + SRN I YI+ LTY ++++ T Sbjct 66 IRSAIEYGPACMSNSSKTKSPQKWVDEDCLHKSRNCAIAVYIHGGGLTYDSAVMFNDT 123 > 7295029 Length=1274 Score = 28.5 bits (62), Expect = 2.9, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 0/37 (0%) Query 32 PRWYEAPLSRNSLIIWYINVNILTYVLSLIYTQTHWS 68 P+W APL+ + ++ + V +L + LS Y Q W+ Sbjct 766 PKWRPAPLAVVNTMVTHGRVELLAHPLSQKYLQMKWN 802 > Hs21040235 Length=384 Score = 28.5 bits (62), Expect = 3.2, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 15/26 (57%), Gaps = 0/26 (0%) Query 22 PGISTLTSTPPRWYEAPLSRNSLIIW 47 PG+S L + P W+ P R+ ++W Sbjct 275 PGVSKLPNYNPEWFPLPTPRSLHVVW 300 Lambda K H 0.328 0.138 0.477 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1164659894 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40