bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_5044_orf1 Length=63 Score E Sequences producing significant alignments: (Bits) Value At4g21820 28.9 2.3 7300153 26.9 9.9 > At4g21820 Length=1088 Score = 28.9 bits (63), Expect = 2.3, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Query 21 CSVHTPQRTPAAKLRRSFSNFFAPPRT----CQRAKPPSPQ 57 C+ P R PA+ L SNF P RT +K P P Sbjct 8 CASPAPPRNPASSLLSDISNFKTPRRTSVVNSNISKSPYPH 48 > 7300153 Length=1298 Score = 26.9 bits (58), Expect = 9.9, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 0/34 (0%) Query 5 PGRAANPQLYVHPARGCSVHTPQRTPAAKLRRSF 38 P A+ Q Y P R + TP RTP + ++R+ Sbjct 358 PPSASPSQRYKTPKRPAGITTPNRTPQSLMKRAL 391 Lambda K H 0.322 0.133 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1172754882 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40