bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_4892_orf2 Length=115 Score E Sequences producing significant alignments: (Bits) Value At2g34210 29.6 1.5 Hs7661856 27.3 6.7 > At2g34210 Length=990 Score = 29.6 bits (65), Expect = 1.5, Method: Compositional matrix adjust. Identities = 24/81 (29%), Positives = 34/81 (41%), Gaps = 9/81 (11%) Query 7 KKWGGWGFLSP-------GESGSKGGGPFPGFPPGGGGGGSFSPFRWVLRGSGFPVCQGF 59 + W + +SP G GS G P+ PG G S +P R R +G P+ GF Sbjct 786 RAWNPYMPMSPPRDNWEDGNPGSWGTSPYEAATPGSDWGSS-TPGRSSYRDAGTPINNGF 844 Query 60 -FFLGGFGAIPPCPGAGGAPS 79 ++L A P P + S Sbjct 845 VYYLLCLNANAPSPMTPSSTS 865 > Hs7661856 Length=1083 Score = 27.3 bits (59), Expect = 6.7, Method: Compositional matrix adjust. Identities = 22/59 (37%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Query 34 GGGGGGSFSPFRWVLRGSGFPVCQGFFFLGGFGAIPPCPGAGGAPSQVQGARFFFFFGR 92 G GGG F F L SGF QGFF G + P P A AR ++F R Sbjct 766 GIDGGGIFREFLNELLKSGFNPNQGFFKTTNEGLLYPNPAAQMLVGD-SFARHYYFLAR 823 Lambda K H 0.320 0.148 0.507 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1178471386 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40