bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_4873_orf2 Length=121 Score E Sequences producing significant alignments: (Bits) Value At5g43240 29.6 1.5 Hs18545190 28.9 2.2 Hs18563592 28.9 2.7 SPCC70.04c 28.1 3.8 Hs20536679 28.1 3.9 At4g39240 27.3 7.0 > At5g43240 Length=512 Score = 29.6 bits (65), Expect = 1.5, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 0/31 (0%) Query 62 LLIRLFFYPLGEIGKIPFYFKKLTRIGVGCF 92 LL F P+G I ++ +KK +I +GCF Sbjct 35 LLFSFFTLPMGTIVRLLEMYKKSQKIAIGCF 65 > Hs18545190 Length=1124 Score = 28.9 bits (63), Expect = 2.2, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 17/35 (48%), Gaps = 0/35 (0%) Query 11 PIFFAWGNFPFSPVGFLGKRPARFPFPKFCPPCWG 45 P F G+ PF P+G LG R P + PP G Sbjct 1049 PRGFLPGHAPFRPLGSLGPREYFIPGTRLPPPTHG 1083 > Hs18563592 Length=102 Score = 28.9 bits (63), Expect = 2.7, Method: Compositional matrix adjust. Identities = 18/48 (37%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Query 24 VGFLGKRPARF---PFPKFCPPCWGMEICRVYFLVKFRVNFLLIRLFF 68 GF+GKRP R FP+ PP G C V + V + RLF+ Sbjct 43 AGFVGKRPLRLQVNTFPEASPPHMGKCQCIVVTIEAIIVATTMARLFW 90 > SPCC70.04c Length=244 Score = 28.1 bits (61), Expect = 3.8, Method: Compositional matrix adjust. Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 0/34 (0%) Query 85 TRIGVGCFPFWKKDPLFKKGGPHRQGGKTRFWGG 118 + + +G FP+ + DP+ K G H + R WG Sbjct 66 SSLSIGNFPYKEFDPVLKFPGIHYTYSRERLWGT 99 > Hs20536679 Length=536 Score = 28.1 bits (61), Expect = 3.9, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 19/39 (48%), Gaps = 5/39 (12%) Query 14 FAWGNFPFSPVGFLGKRPAR-----FPFPKFCPPCWGME 47 FA PFSP+ F G AR FP+ K PPC E Sbjct 416 FACPRRPFSPLLFQGNGSARSTPKGFPWGKEPPPCQSSE 454 > At4g39240 Length=375 Score = 27.3 bits (59), Expect = 7.0, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Query 16 WGNFPFSPVGFLGKRPARFPFPKFCP-PCWGMEICRV 51 W F P G P P F PCWGM I + Sbjct 101 WYTLNFKPFGNDSNNHRLVPIPSFPSIPCWGMSIVAI 137 Lambda K H 0.333 0.159 0.588 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1198419392 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40