bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_4873_orf1 Length=100 Score E Sequences producing significant alignments: (Bits) Value YCR017c_1 32.0 0.30 CE27599 26.9 8.5 > YCR017c_1 Length=543 Score = 32.0 bits (71), Expect = 0.30, Method: Compositional matrix adjust. Identities = 29/108 (26%), Positives = 46/108 (42%), Gaps = 26/108 (24%) Query 7 KKKKKKKKKKKKKKIKKKKKKKKKKFGG--RLGPFIFKLGKVFVGGRFWG-------SLG 57 ++K + +K +KK++K+K + G R F + L +F G FW S+ Sbjct 235 EEKSSELQKSGEKKVEKEKPVARSATGSYFRFDSFFYLLTNIFNGFLFWSNVTSLLCSIW 294 Query 58 NFPFW--------GGVLNFRGGVFKRGGGENPGVSPFFS-----LGGI 92 +FP W +L + G +F P VS F+ LGGI Sbjct 295 HFPLWYMGISGYEAAILGYLGPIFLYL----PFVSEAFTQYGVLLGGI 338 > CE27599 Length=305 Score = 26.9 bits (58), Expect = 8.5, Method: Compositional matrix adjust. Identities = 11/33 (33%), Positives = 24/33 (72%), Gaps = 0/33 (0%) Query 7 KKKKKKKKKKKKKKIKKKKKKKKKKFGGRLGPF 39 + K++++ KK++K+++K KK++K + G PF Sbjct 213 QDKQREEMKKQQKELEKSKKQRKTRAAGEQDPF 245 Lambda K H 0.321 0.147 0.472 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1187882580 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40