bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_4821_orf2 Length=107 Score E Sequences producing significant alignments: (Bits) Value Hs19923961 30.4 0.72 YCL059c 29.3 2.1 At1g21240 28.9 2.4 > Hs19923961 Length=236 Score = 30.4 bits (67), Expect = 0.72, Method: Compositional matrix adjust. Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 5/54 (9%) Query 31 TKWRAQSVGRVDTAAGGMFASLKMGILHGVLTDCNVGTAFYLQSRVLHSIVGPC 84 T ++ QSVG G L G+ + TDC + FY + VL +++ PC Sbjct 32 THFQEQSVGE-----RGAAIQLAEGLARQLCTDCQLNKLFYREEFVLATLLDPC 80 > YCL059c Length=316 Score = 29.3 bits (64), Expect = 2.1, Method: Compositional matrix adjust. Identities = 14/37 (37%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Query 15 SCRGRDSEWDCSTPDETKWRAQSVGRVDTAAGGMFAS 51 S RD WD T D KW+ + D A+G FA Sbjct 3 STHNRDKPWD--TDDIDKWKIEEFKEEDNASGQPFAE 37 > At1g21240 Length=741 Score = 28.9 bits (63), Expect = 2.4, Method: Composition-based stats. Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Query 3 ISATHSSCYRARSCRGRDSEWDCSTP 28 IS TH+ C ++CR RD +DC P Sbjct 298 ISDTHN-CSDPKTCRNRDGGFDCKCP 322 Lambda K H 0.320 0.129 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1164169380 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40