bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_4731_orf3 Length=162 Score E Sequences producing significant alignments: (Bits) Value Hs22064210 28.9 4.7 > Hs22064210 Length=960 Score = 28.9 bits (63), Expect = 4.7, Method: Compositional matrix adjust. Identities = 21/44 (47%), Positives = 25/44 (56%), Gaps = 8/44 (18%) Query 9 KGPHPSPGG--IFFPRGLKGIFVSP-----QGGERAGRYPHLTG 45 +G PSPGG + FPRGL F P +GGE AG+ P LT Sbjct 795 QGTCPSPGGGRVLFPRGLAHPFSVPPAWVQEGGEAAGK-PALTS 837 Lambda K H 0.316 0.141 0.468 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2244926132 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40