bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_4731_orf2 Length=107 Score E Sequences producing significant alignments: (Bits) Value 7302511 28.5 3.5 7302638 27.3 7.4 > 7302511 Length=1218 Score = 28.5 bits (62), Expect = 3.5, Method: Composition-based stats. Identities = 24/67 (35%), Positives = 30/67 (44%), Gaps = 13/67 (19%) Query 25 PSPPRKRGKETLAPTRTPPRGGANFSPPFPK--------KNFGGNPPRLNGGTAPPVHPP 76 P PP++ K TPPR +N PP PK K F G P R++ TA +HP Sbjct 818 PVPPKRSHKRR----HTPPRPISNGLPPTPKVHMGACFSKIFNGCPLRVH-CTASWIHPE 872 Query 77 GGKQKSL 83 Q L Sbjct 873 TRDQHLL 879 > 7302638 Length=165 Score = 27.3 bits (59), Expect = 7.4, Method: Compositional matrix adjust. Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Query 36 LAPTRTPPRGGANFSPPFPKKNFGGNPPRLNGGTAPPVHPPGGKQKSLSNPGG 88 AP P+ F PP+PK+ + G+ P + PPG K + N G Sbjct 95 FAPCSNVPQFKGKFQPPWPKRTYIGDKCVFEAEGFPDIVPPGF-YKIIFNCTG 146 Lambda K H 0.310 0.139 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1164169380 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40