bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_4731_orf1 Length=162 Score E Sequences producing significant alignments: (Bits) Value 7290469 31.6 0.80 At5g42610 27.7 9.4 At1g20810 27.7 10.0 > 7290469 Length=510 Score = 31.6 bits (70), Expect = 0.80, Method: Compositional matrix adjust. Identities = 22/86 (25%), Positives = 34/86 (39%), Gaps = 2/86 (2%) Query 23 FFFFFFFFFKQAPT-PGEEGLFSQKIPWPRNRVLKAPGFGPFFSHPFKKVFAPRGAKKPI 81 F+ + F K+ EE L+++K+ +PR R G + P + +P Sbjct 24 FYVHYVDFNKRLDEWVNEEDLYTRKVQFPR-RDGSQTGTSTGVTTPQRHHSLAGSVSRPT 82 Query 82 PPPEAGKGNVGAHPYPPPGGGQFFPP 107 P G G + A P P G PP Sbjct 83 SPQHPGSGALAAIPQTPTGASGSVPP 108 > At5g42610 Length=293 Score = 27.7 bits (60), Expect = 9.4, Method: Compositional matrix adjust. Identities = 13/48 (27%), Positives = 22/48 (45%), Gaps = 0/48 (0%) Query 14 FFFFFFFFFFFFFFFFFFKQAPTPGEEGLFSQKIPWPRNRVLKAPGFG 61 FF F + FF + + P EGLF Q+ + ++++ GF Sbjct 224 ICFFVTTIHFILGYIFFLRTSTEPSFEGLFRQRFKTKQKKLMERHGFD 271 > At1g20810 Length=232 Score = 27.7 bits (60), Expect = 10.0, Method: Compositional matrix adjust. Identities = 20/44 (45%), Positives = 23/44 (52%), Gaps = 4/44 (9%) Query 76 GAKKPIPPPEAGKGNVGAHPYPPPGGGQFFPPLSQEKLRGEPPP 119 G + I PPEAG G G + PP G F L+ E LR PPP Sbjct 190 GKRTVIVPPEAGYGQKGMNEIPP--GATF--ELNIELLRVTPPP 229 Lambda K H 0.332 0.156 0.570 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2244926132 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40