bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_4714_orf1 Length=166 Score E Sequences producing significant alignments: (Bits) Value At4g28440 30.0 2.4 At2g36810 29.3 4.1 > At4g28440 Length=153 Score = 30.0 bits (66), Expect = 2.4, Method: Compositional matrix adjust. Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Query 115 QTTEAVVADETGAVLLLLETDAQRQLCQPGTEVLLLNVTVSCVGGFVCL 163 + E ++ DETG +L D Q L +PG V+L N + G + L Sbjct 68 RIVECLIGDETGCILFTARND-QVDLMKPGATVILRNSRIDMFKGTMRL 115 > At2g36810 Length=1071 Score = 29.3 bits (64), Expect = 4.1, Method: Compositional matrix adjust. Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 10/49 (20%) Query 85 LPQSGCCCCLVRVLQYLSHSLLKLPSGSLVQTTEAVVADETGAVLLLLE 133 + + CCCC+VRV L++PS + T V+ G +L LL+ Sbjct 805 ISKGSCCCCIVRVYT------LQMPSACMSHYTTQVI----GVILALLD 843 Lambda K H 0.315 0.122 0.337 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2389760076 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40