bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_4685_orf1 Length=78 Score E Sequences producing significant alignments: (Bits) Value Hs5453738 32.3 0.21 AtCh054 28.9 2.2 > Hs5453738 Length=999 Score = 32.3 bits (72), Expect = 0.21, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 0/31 (0%) Query 14 KRADPCGSGSPLLFNLAFLPNLQKVHLLLQL 44 K ADP G+GS ++FN + LP+L ++ L L Sbjct 322 KEADPLGNGSVMIFNTSALPHLYQIKQLQAL 352 > AtCh054 Length=329 Score = 28.9 bits (63), Expect = 2.2, Method: Composition-based stats. Identities = 7/17 (41%), Positives = 14/17 (82%), Gaps = 0/17 (0%) Query 42 LQLPPRVFACFRRTRVH 58 L+LPPR++ C +++ +H Sbjct 279 LELPPRIYNCLKKSNIH 295 Lambda K H 0.330 0.139 0.462 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1171925608 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40