bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_4523_orf1 Length=157 Score E Sequences producing significant alignments: (Bits) Value At5g61900 31.2 0.81 At5g07300 30.4 1.3 7295625 28.5 5.6 > At5g61900 Length=553 Score = 31.2 bits (69), Expect = 0.81, Method: Composition-based stats. Identities = 13/28 (46%), Positives = 20/28 (71%), Gaps = 0/28 (0%) Query 9 VKQFESLRDRQWGDFPVIHATLSELASE 36 + QF +LRD Q+G+ V+ A L+EL S+ Sbjct 511 IVQFVALRDVQYGEISVVQALLAELPSQ 538 > At5g07300 Length=604 Score = 30.4 bits (67), Expect = 1.3, Method: Composition-based stats. Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 5/35 (14%) Query 9 VKQFESLRDRQWGDFPVIHATLSELASESPPTQAL 43 + QF +LRD Q+G+ V+ A L+EL PTQ L Sbjct 557 IVQFVALRDIQYGEVSVVEALLAEL-----PTQFL 586 > 7295625 Length=708 Score = 28.5 bits (62), Expect = 5.6, Method: Composition-based stats. Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 0/29 (0%) Query 122 GRRFAAFPSADPECCADFISRLNGGWLDG 150 GR +A + PE CA I +NGG +DG Sbjct 576 GRGYAFVEYSRPEDCASAIKHMNGGQIDG 604 Lambda K H 0.319 0.134 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2106641548 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40