bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_4341_orf1 Length=110 Score E Sequences producing significant alignments: (Bits) Value CE23705 29.3 1.9 At3g28030 29.3 1.9 CE28928 28.9 2.2 > CE23705 Length=694 Score = 29.3 bits (64), Expect = 1.9, Method: Composition-based stats. Identities = 13/40 (32%), Positives = 23/40 (57%), Gaps = 0/40 (0%) Query 40 KRRTMDRARPVLRSQTRTAKRRKNENTNTKRRKRKKRSTG 79 +R+ M +A+ L + +RRKN+N N + +KR+ G Sbjct 507 RRQRMTKAQMSLMTDEEKVERRKNQNRNYSKTHVQKRNRG 546 > At3g28030 Length=1482 Score = 29.3 bits (64), Expect = 1.9, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 0/32 (0%) Query 45 DRARPVLRSQTRTAKRRKNENTNTKRRKRKKR 76 D A P L+ +T A+RR+ EN TK RK ++ Sbjct 77 DGATPALKRRTVIARRRQRENAQTKIRKTAEK 108 > CE28928 Length=360 Score = 28.9 bits (63), Expect = 2.2, Method: Compositional matrix adjust. Identities = 14/44 (31%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Query 2 SKREMHRGLVACRKQKFKQMKTTTIMVEKSPK-PTKTLKKRRTM 44 +K+ MH+ V CR + ++++ E++ K PT T+K+RR + Sbjct 242 TKKNMHKITVVCRYIENHYYISSSLFSEETSKIPTSTMKERRVL 285 Lambda K H 0.320 0.127 0.353 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1195973986 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40