bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_4305_orf4 Length=69 Score E Sequences producing significant alignments: (Bits) Value At2g30390 30.4 0.92 At5g26030 26.9 8.8 > At2g30390 Length=512 Score = 30.4 bits (67), Expect = 0.92, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 0/33 (0%) Query 28 LLLLNISFPIXIKNIFPFLITLFYSPKLLTISP 60 +LLLN+ P + ++ PFL LF P ++ + P Sbjct 103 VLLLNLGGPETLDDVQPFLFNLFADPDIIRLPP 135 > At5g26030 Length=466 Score = 26.9 bits (58), Expect = 8.8, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 19/31 (61%), Gaps = 0/31 (0%) Query 28 LLLLNISFPIXIKNIFPFLITLFYSPKLLTI 58 +LLLN+ P + ++ PFL LF P ++ + Sbjct 92 VLLLNLGGPETLNDVQPFLYNLFADPDIIRL 122 Lambda K H 0.337 0.155 0.478 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1200381448 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40