bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_4305_orf3 Length=51 Score E Sequences producing significant alignments: (Bits) Value Hs13375634 28.9 2.3 At2g03770 27.3 7.1 > Hs13375634 Length=2406 Score = 28.9 bits (63), Expect = 2.3, Method: Composition-based stats. Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query 10 LLHKPFFQTPTTHHFYSPPPI-LFSYPHFL 38 + H P QTP Y PPP+ LFS+ H + Sbjct 1123 VFHHPVAQTPLHEKPYLPPPVSLFSFQHLV 1152 > At2g03770 Length=324 Score = 27.3 bits (59), Expect = 7.1, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 5/38 (13%) Query 10 LLHKPFFQTPTTHHFYSPPPILFSYPHFLYLYINKFFL 47 L+H+ FQTP H P+L + PH L +I F L Sbjct 89 LIHRQEFQTPLVSH-----PLLDNNPHTLVTFIEGFHL 121 Lambda K H 0.339 0.156 0.535 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1161614636 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40