bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_4287_orf3 Length=64 Score E Sequences producing significant alignments: (Bits) Value Hs4504795 30.4 0.92 Hs20546083 28.1 3.9 7293935 27.7 5.8 > Hs4504795 Length=2671 Score = 30.4 bits (67), Expect = 0.92, Method: Composition-based stats. Identities = 15/43 (34%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Query 21 CLHRPCKENRKSAQEPFLRACPIREERTRIIR-LMLSSLQRAA 62 CL + C NR SAQ+ + +A ++++ +I ++L LQ AA Sbjct 55 CLFKVCPMNRYSAQKQYWKAKQTKQDKEKIADVVLLQKLQHAA 97 > Hs20546083 Length=427 Score = 28.1 bits (61), Expect = 3.9, Method: Composition-based stats. Identities = 10/25 (40%), Positives = 17/25 (68%), Gaps = 3/25 (12%) Query 1 LSICYESCSPTNMFQRGVSFCLHRP 25 LS+C+ C P++ R ++FC+ RP Sbjct 208 LSVCWSGCEPSS---RSLAFCVARP 229 > 7293935 Length=273 Score = 27.7 bits (60), Expect = 5.8, Method: Composition-based stats. Identities = 18/48 (37%), Positives = 23/48 (47%), Gaps = 4/48 (8%) Query 8 CSP-TNMFQRGVSFCLHRPCKENRKS---AQEPFLRACPIREERTRII 51 C P T F G+ C R E K EPF++A +R ERT +I Sbjct 212 CIPGTGAFVAGIEACSEREALEMGKPNPLVLEPFIKAEGLRTERTLMI 259 Lambda K H 0.330 0.137 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1169706042 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40