bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_4287_orf2 Length=59 Score E Sequences producing significant alignments: (Bits) Value 7292854 27.7 5.0 Hs22061701 27.7 5.2 At1g44880 26.9 8.1 > 7292854 Length=355 Score = 27.7 bits (60), Expect = 5.0, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 21/31 (67%), Gaps = 2/31 (6%) Query 20 ILYALQFHQEFIPALFAEVVSRHQSPSRLQI 50 ++Y L FHQE PA++ + R ++PSR+ + Sbjct 29 LVYFLNFHQEERPAIYGML--RSENPSRVNL 57 > Hs22061701 Length=1152 Score = 27.7 bits (60), Expect = 5.2, Method: Compositional matrix adjust. Identities = 15/62 (24%), Positives = 32/62 (51%), Gaps = 4/62 (6%) Query 1 ETNIQKHGVCYDQHLDSC----TILYALQFHQEFIPALFAEVVSRHQSPSRLQIELHSLT 56 E + H + + D+C ++++ L++ +IP L A+++ SP+ I +HS+ Sbjct 221 ENKVLFHSASFQRLSDACRALESLMFPLKYSYPYIPILPAQLLEVLSSPTPFIIGVHSVF 280 Query 57 HT 58 T Sbjct 281 KT 282 > At1g44880 Length=1038 Score = 26.9 bits (58), Expect = 8.1, Method: Composition-based stats. Identities = 10/25 (40%), Positives = 18/25 (72%), Gaps = 0/25 (0%) Query 12 DQHLDSCTILYALQFHQEFIPALFA 36 D+H+DS + YA+ ++EF+ L+A Sbjct 1008 DKHVDSFSRKYAMDIYEEFVCPLYA 1032 Lambda K H 0.326 0.135 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1184950242 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40