bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_4198_orf1 Length=122 Score E Sequences producing significant alignments: (Bits) Value 7293326 29.3 1.7 7300908 28.1 4.3 Hs8922141 27.7 4.8 Hs10047086 27.7 6.2 > 7293326 Length=576 Score = 29.3 bits (64), Expect = 1.7, Method: Composition-based stats. Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 0/38 (0%) Query 52 ATAATLGCPTPSAVLRFQTLRGLTLGFLSPAVQWGVPA 89 A A T P P+ V+R Q +T +PAV + PA Sbjct 236 APAVTYSAPAPAPVVRVQAAPAVTYSAPAPAVTYSAPA 273 > 7300908 Length=919 Score = 28.1 bits (61), Expect = 4.3, Method: Compositional matrix adjust. Identities = 17/64 (26%), Positives = 32/64 (50%), Gaps = 5/64 (7%) Query 38 LLLLLQLQQQQFHTATAATLGCPTPSAVLRFQTLRGLTLGFLSPAVQWGVPACRISRCCI 97 +L L QL+Q Q +A +G P P + + LGFL+ +VQ+ + ++ + Sbjct 295 ILPLYQLEQIQLAPLMSALIGLPPP-----MNNMALMPLGFLNTSVQYELQVLHLNAMQL 349 Query 98 INEA 101 + +A Sbjct 350 LAQA 353 > Hs8922141 Length=122 Score = 27.7 bits (60), Expect = 4.8, Method: Compositional matrix adjust. Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 5/53 (9%) Query 43 QLQQQQFHTATAATLGCPTPSAVLRFQTLRGLTLGFLSPAVQWGVPACRISRC 95 L +++ +AT+A P P L Q L L SPA Q P C + RC Sbjct 58 DLDREELLSATSADTMPPLPGDTLNNQDLLDL-----SPAGQADTPRCALGRC 105 > Hs10047086 Length=462 Score = 27.7 bits (60), Expect = 6.2, Method: Composition-based stats. Identities = 14/29 (48%), Positives = 15/29 (51%), Gaps = 0/29 (0%) Query 69 QTLRGLTLGFLSPAVQWGVPACRISRCCI 97 QT R L PA + PA RIS CCI Sbjct 241 QTHRRLRRSHSGPAGSFNKPAIRISNCCI 269 Lambda K H 0.325 0.135 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1194805952 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40