bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_4088_orf2 Length=95 Score E Sequences producing significant alignments: (Bits) Value Hs22050124 27.3 6.6 Hs14702171 26.9 8.2 > Hs22050124 Length=231 Score = 27.3 bits (59), Expect = 6.6, Method: Compositional matrix adjust. Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Query 46 PATIQLRSN-VITVDPSIDHLSVKKVVDSKLREAQEAALAADAKKG 90 P T L + VI +DPS D + KK + Q +A+D KG Sbjct 18 PTTFTLSAGSVIQIDPSSDTVVPKKYWKDAITRTQGTKIASDGLKG 63 > Hs14702171 Length=275 Score = 26.9 bits (58), Expect = 8.2, Method: Compositional matrix adjust. Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 5/49 (10%) Query 44 IFPATIQLRSNVITVDPSIDHLSVKKVVDSKLREAQEAALAADAKKGLA 92 + P T + R N DP+ D++ ++ KLR+ QE L A AKKG Sbjct 127 VIPVTSRNRDN----DPN-DYVEQDDILIVKLRKGQELRLRAYAKKGFG 170 Lambda K H 0.321 0.135 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1161385214 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40