bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_4037_orf1 Length=126 Score E Sequences producing significant alignments: (Bits) Value CE25593 39.3 0.002 ECU02g0570 30.8 0.61 > CE25593 Length=856 Score = 39.3 bits (90), Expect = 0.002, Method: Composition-based stats. Identities = 24/54 (44%), Positives = 29/54 (53%), Gaps = 13/54 (24%) Query 38 FLKKKWCFAKKKVFPK----KNGFFQKKMVFQTKMAFFKKNG------FWQKKW 81 F KKW KK VF K K+ FF KK +F + AFF+KN F +KKW Sbjct 725 FFGKKW---KKVVFQKFHFEKSNFFIKKKIFHFRQAFFQKNNSKNILFFSRKKW 775 > ECU02g0570 Length=465 Score = 30.8 bits (68), Expect = 0.61, Method: Composition-based stats. Identities = 26/79 (32%), Positives = 34/79 (43%), Gaps = 8/79 (10%) Query 27 ARDSGGWKFEFFLKKKWCFAKKKVFPKKNGFFQKKMVFQTKMA---FFKKNGFWQKKWFL 83 ARD E +L K F+ K F KK F QKK A FF NG ++ Sbjct 385 ARDIQVHDSEVYLNGKLKFSDKHGFRKKMVFIQKKCKLNDLFANSPFFYSNG----SYYF 440 Query 84 PQ-GRGFCPRNGKSSLEKI 101 PQ NGK+ +E++ Sbjct 441 PQKAIRVIMENGKARIERV 459 Lambda K H 0.323 0.146 0.501 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1180352192 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40