bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_4023_orf2 Length=170 Score E Sequences producing significant alignments: (Bits) Value Hs4885401 30.0 2.3 Hs14755975 28.5 7.5 > Hs4885401 Length=268 Score = 30.0 bits (66), Expect = 2.3, Method: Compositional matrix adjust. Identities = 12/41 (29%), Positives = 23/41 (56%), Gaps = 0/41 (0%) Query 91 WAFWERSIAHKDIVNCLRSHYEQQESAYGRLLGSSAVAASQ 131 W + + I+ KD+ N +R H + E A+ +L A+ A++ Sbjct 135 WKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAE 175 > Hs14755975 Length=921 Score = 28.5 bits (62), Expect = 7.5, Method: Compositional matrix adjust. Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 0/35 (0%) Query 66 KAAAEAAAEAAAAAAAGKDPNKGIDWAFWERSIAH 100 + AA+A+ AA A AG+D + G F+E S+ H Sbjct 370 RHAADASRRAAPAEGAGEDEDDGASRIFFEPSLYH 404 Lambda K H 0.321 0.130 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2490594054 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40