bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_4023_orf1 Length=119 Score E Sequences producing significant alignments: (Bits) Value At1g71140 28.5 3.0 7296233 28.1 4.4 > At1g71140 Length=485 Score = 28.5 bits (62), Expect = 3.0, Method: Compositional matrix adjust. Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 0/50 (0%) Query 1 GAAAAASVGFAAAVRAAGQQQMQSSSRSSSRSSSSSSSWQGPKQGHRLGL 50 GAA A V + V G SSS S SR++ S S ++G + R G+ Sbjct 207 GAAIAIGVSYWLNVTVLGLYMTFSSSCSKSRATISMSLFEGMGEFFRFGI 256 > 7296233 Length=968 Score = 28.1 bits (61), Expect = 4.4, Method: Compositional matrix adjust. Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 0/37 (0%) Query 61 CQLPAVALRAARVSLRALAGFFCCCCFAANQQQRRSS 97 C L A+ +V L+ F CC FAA+ QRR S Sbjct 511 CSLLEEAVPQIQVEPDTLSSFHCCSSFAASSLQRRVS 547 Lambda K H 0.321 0.124 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1164469306 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40