bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_4020_orf1 Length=104 Score E Sequences producing significant alignments: (Bits) Value Hs8923055 32.0 0.31 7293025 28.1 4.4 7293022 26.9 9.0 > Hs8923055 Length=959 Score = 32.0 bits (71), Expect = 0.31, Method: Composition-based stats. Identities = 23/64 (35%), Positives = 29/64 (45%), Gaps = 17/64 (26%) Query 48 PNFPKKQKSRFFPRPLI----------FHSQMGLMCLGQSSPSD--APKNYDLGA----- 90 P PK++KS FP PLI +M + LGQ P +P Y LG+ Sbjct 853 PGIPKEKKSFVFPPPLITAVAQPGIKAVPPRMPAVNLGQVPPKHPRSPIPYHLGSLPEGM 912 Query 91 TPNF 94 TPNF Sbjct 913 TPNF 916 > 7293025 Length=700 Score = 28.1 bits (61), Expect = 4.4, Method: Composition-based stats. Identities = 9/19 (47%), Positives = 13/19 (68%), Gaps = 0/19 (0%) Query 18 PKKKDGFPLWGGNLWVGGP 36 P++ D P WGG+ +GGP Sbjct 27 PERFDRLPTWGGHSQIGGP 45 > 7293022 Length=296 Score = 26.9 bits (58), Expect = 9.0, Method: Compositional matrix adjust. Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 7/49 (14%) Query 36 PNCTTGTFWKGAPNFPK--KQKSRFF-----PRPLIFHSQMGLMCLGQS 77 P C T + WK PNF ++ R F PL+F+ +G+ +G + Sbjct 24 PTCRTYSIWKFPPNFDANNQRAGRLFWFSEQIFPLMFYYALGISIIGST 72 Lambda K H 0.316 0.137 0.473 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1174332180 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40