bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_3837_orf2 Length=120 Score E Sequences producing significant alignments: (Bits) Value Hs21914836 28.9 2.4 Hs20536765 28.9 2.5 At1g21830 27.7 5.0 > Hs21914836 Length=1999 Score = 28.9 bits (63), Expect = 2.4, Method: Compositional matrix adjust. Identities = 25/59 (42%), Positives = 32/59 (54%), Gaps = 6/59 (10%) Query 34 SSSRSSRGKRAR--GSNDGETRSEKSSCSSNGSRRNS---SRRNSNRRNSNRRNSSSSS 87 +S S RG RA+ GS + E S+ N SRR+S RR+ RRNSN +S SS Sbjct 572 TSLFSFRG-RAKDVGSENDFADDEHSTFEDNESRRDSLFVPRRHGERRNSNLSQTSRSS 629 > Hs20536765 Length=1649 Score = 28.9 bits (63), Expect = 2.5, Method: Compositional matrix adjust. Identities = 25/59 (42%), Positives = 32/59 (54%), Gaps = 6/59 (10%) Query 34 SSSRSSRGKRAR--GSNDGETRSEKSSCSSNGSRRNS---SRRNSNRRNSNRRNSSSSS 87 +S S RG RA+ GS + E S+ N SRR+S RR+ RRNSN +S SS Sbjct 223 TSLFSFRG-RAKDVGSENDFADDEHSTFEDNESRRDSLFVPRRHGERRNSNLSQTSRSS 280 > At1g21830 Length=91 Score = 27.7 bits (60), Expect = 5.0, Method: Compositional matrix adjust. Identities = 11/33 (33%), Positives = 16/33 (48%), Gaps = 0/33 (0%) Query 5 SSALCFRGPSKATLATCKLCLRRRICCSSSSSR 37 SS C+ P + + C LCL R+ +S R Sbjct 6 SSPYCYFHPKEEYVGVCPLCLNERLLVLASKQR 38 Lambda K H 0.306 0.111 0.314 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1160968786 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40