bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_3837_orf1 Length=177 Score E Sequences producing significant alignments: (Bits) Value 7293908 28.5 7.5 7291428 28.5 7.6 > 7293908 Length=918 Score = 28.5 bits (62), Expect = 7.5, Method: Compositional matrix adjust. Identities = 19/65 (29%), Positives = 50/65 (76%), Gaps = 0/65 (0%) Query 113 EEQLQQQRQQEKQQQEKQQQEKQQQEKQQQQQQLLQQQLQQQQLQQQQLQQQQLQQQQLQ 172 EEQ+++Q+ +E+ +E+Q +E+Q +E+Q +++++ ++QL+++++Q+QQ Q ++++ Q Sbjct 696 EEQIREQQIKEELFREEQIKEEQFREEQLREEEVRREQLREEEIQRQQAQILRIREAQYS 755 Query 173 QQQLQ 177 +Q + Sbjct 756 EQSFK 760 Score = 28.1 bits (61), Expect = 8.7, Method: Compositional matrix adjust. Identities = 18/58 (31%), Positives = 47/58 (81%), Gaps = 0/58 (0%) Query 115 QLQQQRQQEKQQQEKQQQEKQQQEKQQQQQQLLQQQLQQQQLQQQQLQQQQLQQQQLQ 172 +L++ R E+Q +E+Q +E+ +E+Q +++Q ++QL++++++++QL+++++Q+QQ Q Sbjct 688 ELREARILEEQIREQQIKEELFREEQIKEEQFREEQLREEEVRREQLREEEIQRQQAQ 745 > 7291428 Length=1991 Score = 28.5 bits (62), Expect = 7.6, Method: Compositional matrix adjust. Identities = 21/64 (32%), Positives = 47/64 (73%), Gaps = 3/64 (4%) Query 116 LQQQR---QQEKQQQEKQQQEKQQQEKQQQQQQLLQQQLQQQQLQQQQLQQQQLQQQQLQ 172 L++QR Q+EK+Q+EK+Q+E++Q+EK+Q++++ +++L+ ++ ++++ +QQ L Sbjct 1420 LREQREKEQREKEQREKEQREREQREKEQREKEARERKLRDEERERERERQQLLTASHHY 1479 Query 173 QQQL 176 QL Sbjct 1480 SNQL 1483 Lambda K H 0.308 0.118 0.303 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2743263016 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40