bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_3826_orf2 Length=96 Score E Sequences producing significant alignments: (Bits) Value At4g14310_2 34.7 0.050 At4g25300 29.6 1.4 Hs7706190 29.3 1.7 YDR128w 29.3 2.0 ECU09g1320 28.1 4.1 Hs14738297 27.3 6.3 > At4g14310_2 Length=304 Score = 34.7 bits (78), Expect = 0.050, Method: Composition-based stats. Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 0/63 (0%) Query 2 RGPYRSISPRSGGESPAINLGGLSIIGLGEGQGVIRCFCFRRSASFFCSHCSAILPHSMV 61 R P++ + + G + P I L +I ++ FC S S FCS S+ L ++ Sbjct 104 RRPWKLVKHKLGKDYPTIQLTAWKVINETHYHFILLHFCMCLSNSVFCSAASSPLAVGVI 163 Query 62 EWL 64 WL Sbjct 164 NWL 166 > At4g25300 Length=356 Score = 29.6 bits (65), Expect = 1.4, Method: Composition-based stats. Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Query 3 GPYRSISPRS--GGESPAINLGGLSIIGLGEGQGVIRCFCFRRSASFFCS 50 G YRSI R E +++ IGLG+ G +R R A+FF S Sbjct 281 GTYRSIEHRGVVNSEKERLSVAAFHNIGLGKEIGPMRSLVERHKAAFFKS 330 > Hs7706190 Length=3674 Score = 29.3 bits (64), Expect = 1.7, Method: Composition-based stats. Identities = 13/25 (52%), Positives = 14/25 (56%), Gaps = 4/25 (16%) Query 72 RCRELEEGWAWAWTNCGGVLACSWG 96 R +ELEE WA W C A SWG Sbjct 3401 RLQELEEAWALRWQRC----AESWG 3421 > YDR128w Length=1148 Score = 29.3 bits (64), Expect = 2.0, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 17/38 (44%), Gaps = 6/38 (15%) Query 45 ASFFCSHCSAILPHSMVEWLWDF------GCSCRCREL 76 +SF C +C +L S W+ GC C C E+ Sbjct 1108 SSFICGNCQHVLHSSCARIWWEIGDECPSGCGCNCPEM 1145 > ECU09g1320 Length=597 Score = 28.1 bits (61), Expect = 4.1, Method: Composition-based stats. Identities = 11/23 (47%), Positives = 16/23 (69%), Gaps = 0/23 (0%) Query 1 ERGPYRSISPRSGGESPAINLGG 23 E+ P R+ SP SGG +P++ GG Sbjct 331 EQKPQRTSSPPSGGSNPSVQQGG 353 > Hs14738297 Length=107 Score = 27.3 bits (59), Expect = 6.3, Method: Compositional matrix adjust. Identities = 10/19 (52%), Positives = 13/19 (68%), Gaps = 0/19 (0%) Query 8 ISPRSGGESPAINLGGLSI 26 +SPR GG PA+ GG+ I Sbjct 9 LSPRKGGHPPAVKAGGMRI 27 Lambda K H 0.326 0.142 0.536 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1201432980 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40