bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_3820_orf1 Length=112 Score E Sequences producing significant alignments: (Bits) Value Hs22041368 29.3 1.8 7290128 29.3 2.1 CE05611 28.1 3.9 YDL223c 28.1 3.9 At5g14080 27.3 6.6 Hs18583039 27.3 6.7 7292666 27.3 6.9 Hs14760084 27.3 7.8 Hs22041206 26.9 8.2 Hs19424134 26.9 8.9 > Hs22041368 Length=927 Score = 29.3 bits (64), Expect = 1.8, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Query 1 TSDCVCVCTLISRTYLLRVERQTHTHIHTHTHT--HRERE 38 + DC T + TY+ E + H H +T HT HR+R+ Sbjct 146 SKDCHIPVTKKALTYVAHNEHKFHAHTYTQVHTCMHRKRD 185 > 7290128 Length=738 Score = 29.3 bits (64), Expect = 2.1, Method: Composition-based stats. Identities = 9/24 (37%), Positives = 15/24 (62%), Gaps = 0/24 (0%) Query 23 THTHIHTHTHTHRERETHTHTHAH 46 +H H H H HTH +H++++ H Sbjct 624 SHAHGHAHQHTHGHAHSHSNSNKH 647 > CE05611 Length=375 Score = 28.1 bits (61), Expect = 3.9, Method: Composition-based stats. Identities = 9/17 (52%), Positives = 10/17 (58%), Gaps = 0/17 (0%) Query 30 HTHTHRERETHTHTHAH 46 H H HR+R H HAH Sbjct 305 HLHVHRDRHYHDERHAH 321 Score = 27.7 bits (60), Expect = 5.6, Method: Composition-based stats. Identities = 9/30 (30%), Positives = 13/30 (43%), Gaps = 0/30 (0%) Query 21 RQTHTHIHTHTHTHRERETHTHTHAHARIY 50 ++ H H+H H H ER H +Y Sbjct 302 QENHLHVHRDRHYHDERHAHQDDSQQFSVY 331 > YDL223c Length=1046 Score = 28.1 bits (61), Expect = 3.9, Method: Composition-based stats. Identities = 12/23 (52%), Positives = 13/23 (56%), Gaps = 2/23 (8%) Query 29 THTHTHRERETH--THTHAHARI 49 THTH H T THTH HA + Sbjct 192 THTHGHSSATTSPVTHTHGHASV 214 Score = 27.7 bits (60), Expect = 4.9, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 10/36 (27%) Query 23 THTHIH--------THTHTHRERETH--THTHAHAR 48 THTH H THTH H +T T+TH H++ Sbjct 192 THTHGHSSATTSPVTHTHGHASVKTTSPTNTHEHSK 227 Score = 26.9 bits (58), Expect = 8.7, Method: Composition-based stats. Identities = 13/50 (26%), Positives = 19/50 (38%), Gaps = 0/50 (0%) Query 23 THTHIHTHTHTHRERETHTHTHAHARIYMVRICIIHVYIKYIQYIERAHT 72 THTH H T TH H+ A+ H+ +K + H+ Sbjct 206 THTHGHASVKTTSPTNTHEHSKANTGPSATATTHGHINVKTTHPVSHGHS 255 > At5g14080 Length=663 Score = 27.3 bits (59), Expect = 6.6, Method: Composition-based stats. Identities = 24/90 (26%), Positives = 41/90 (45%), Gaps = 14/90 (15%) Query 10 LISRTYLLRVERQTHTHIHTHTHTHRERETHTHTHAHARIYMVRICI-----IHVYIKYI 64 L+SR L+R+ H + RERE HT AH ++ C+ + + I+++ Sbjct 566 LMSRYLLIRLVCMCEGHSGEASQLLREREHLEHTGAHV---VLLKCVADAKEVEIGIRHM 622 Query 65 QYIERAHTCLGMRPYMYIVVSGCLRAQPCS 94 Q+I+ + P + +S L A CS Sbjct 623 QWIKE------VSPSLVHTISSDLLASFCS 646 > Hs18583039 Length=935 Score = 27.3 bits (59), Expect = 6.7, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 15/32 (46%), Gaps = 0/32 (0%) Query 4 CVCVCTLISRTYLLRVERQTHTHIHTHTHTHR 35 C+ VC ++ + L QTH H HT R Sbjct 132 CLAVCEVLPSVHTLGAVVQTHVETHAEGHTDR 163 > 7292666 Length=427 Score = 27.3 bits (59), Expect = 6.9, Method: Compositional matrix adjust. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query 57 IHVYIKYIQ-YIERAHTCLGMRPYMYIVVSGCLR 89 I VY +I+ Y E+ LG P+M +V + C R Sbjct 135 IQVYASFIEIYNEKPFDLLGSTPHMPMVAARCQR 168 > Hs14760084 Length=532 Score = 27.3 bits (59), Expect = 7.8, Method: Compositional matrix adjust. Identities = 15/41 (36%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Query 40 HTHTHAHARIYMVRICIIHVYIKYIQYIERAHTCLGMRPYM 80 H TH + Y + C YI+Y ER HT G +PY Sbjct 469 HERTHTGEKPYECKHCGKAFISNYIRYHERTHT--GEKPYQ 507 > Hs22041206 Length=784 Score = 26.9 bits (58), Expect = 8.2, Method: Composition-based stats. Identities = 10/24 (41%), Positives = 13/24 (54%), Gaps = 0/24 (0%) Query 25 THIHTHTHTHRERETHTHTHAHAR 48 TH H R+R+TH H +H R Sbjct 733 THKDEQNHQRRDRQTHEHEQSHQR 756 > Hs19424134 Length=376 Score = 26.9 bits (58), Expect = 8.9, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Query 22 QTHTHI-HTHTH--THRERETHTHTHAHARIY 50 Q H H+ H H+H H +H H H H + Sbjct 185 QAHGHVDHCHSHEVKHGAAHSHDHAHGHGHFH 216 Lambda K H 0.332 0.138 0.473 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1188972946 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40