bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_3629_orf8 Length=114 Score E Sequences producing significant alignments: (Bits) Value 7300097 29.3 1.7 Hs17486520 28.5 3.5 Hs22069317 28.1 4.5 At1g50030 27.3 7.3 7292205 26.9 9.5 > 7300097 Length=259 Score = 29.3 bits (64), Expect = 1.7, Method: Compositional matrix adjust. Identities = 17/42 (40%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Query 43 GTSFHLLVLLRLQPNLLRFLLSL-LPLLHLLLDCRKSPRIVV 83 G S H + LRL+P+ L+F+LSL P LH+ D +I++ Sbjct 105 GISKHTVNELRLEPSKLKFILSLTFPKLHMESDYSIKGKIMM 146 > Hs17486520 Length=520 Score = 28.5 bits (62), Expect = 3.5, Method: Compositional matrix adjust. Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Query 55 QPNLLRFLLSLLPLLHLLLDCRKSPRIVVAKNPATLL 91 QP LL LL+ LPLLH DC+++P + + +P L Sbjct 405 QPALLGPLLAFLPLLH--RDCKEAPHLGSSGSPVQAL 439 > Hs22069317 Length=542 Score = 28.1 bits (61), Expect = 4.5, Method: Compositional matrix adjust. Identities = 13/29 (44%), Positives = 15/29 (51%), Gaps = 0/29 (0%) Query 10 WCPSPVLHLSHLPLLLYAQASLLQAHSAH 38 WCPSP+LHL L + A Q H H Sbjct 224 WCPSPLLHLEELCPVPQGGARGPQGHGWH 252 > At1g50030 Length=2467 Score = 27.3 bits (59), Expect = 7.3, Method: Compositional matrix adjust. Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 3/35 (8%) Query 75 CRKSPRIVVAKNPATLLVPLEPVVESVAPQELGLH 109 CRKS RI AK+ L+P +P V+P+ + H Sbjct 1625 CRKSGRISQAKSTLLKLLPFDP---EVSPENMQYH 1656 > 7292205 Length=485 Score = 26.9 bits (58), Expect = 9.5, Method: Compositional matrix adjust. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 0/33 (0%) Query 40 YQMGTSFHLLVLLRLQPNLLRFLLSLLPLLHLL 72 Y GTSF L+L+R P L+ L L+ + ++ Sbjct 281 YSAGTSFGALLLMRYTPKLVYLLFGLIQITSIV 313 Lambda K H 0.326 0.140 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1181971906 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40