bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_3629_orf6 Length=101 Score E Sequences producing significant alignments: (Bits) Value 7303289 30.0 1.0 CE03654 28.9 2.3 7302124 28.9 2.6 Hs20127408 28.9 2.7 CE28716 27.7 5.7 > 7303289 Length=717 Score = 30.0 bits (66), Expect = 1.0, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 0/34 (0%) Query 24 QGRDPVRRLKAASSPVVRTTNHSGSALGGGLKAT 57 Q P RR + ++P +R ++S A+GGGLK T Sbjct 291 QNLQPERRARLNTAPGMRVGSNSSIAMGGGLKRT 324 > CE03654 Length=633 Score = 28.9 bits (63), Expect = 2.3, Method: Composition-based stats. Identities = 23/78 (29%), Positives = 32/78 (41%), Gaps = 11/78 (14%) Query 21 CIHQGRDPVRRLKAASSPVVRTTNHSGSA-------LGGGLKATITAVPECSPTDHNAVR 73 CI G DP LK P + T ++ A G + P C+P D NA Sbjct 473 CIDYGADPNLILKEPVKPSQKITWYTSDAGEGKRGRCGRDVPPLEGEAPTCNPDDANAHC 532 Query 74 CSD---CGKQARGICSCS 88 CS+ CG ++ C C+ Sbjct 533 CSNGGYCG-NSKEHCECN 549 > 7302124 Length=1167 Score = 28.9 bits (63), Expect = 2.6, Method: Composition-based stats. Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 5/43 (11%) Query 17 HSRICIHQGRDPVRRLK----AASSPV-VRTTNHSGSALGGGL 54 H+ +C+H G V+ +K A+SPV +R H+G+ L G L Sbjct 367 HAVLCVHMGLSMVKAIKYVQQKANSPVDMRVGIHTGAVLAGIL 409 > Hs20127408 Length=763 Score = 28.9 bits (63), Expect = 2.7, Method: Composition-based stats. Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Query 29 VRRLKAASSPVVRTTNHSGSALGGGLKATITAVPECSPTDHNAV 72 V +L+ ++ P+V N GS LGGGL+ I+ + D V Sbjct 127 VEKLEKSTKPIVAAIN--GSCLGGGLEVAISCQYRIATKDRKTV 168 > CE28716 Length=368 Score = 27.7 bits (60), Expect = 5.7, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Query 6 ITPRH-VSDICSHSRICIHQGRDPVRRLKAASSPVVRTTNHSGSALGGGLKATITAVPEC 64 +T H ++ + +RIC ++ D +L A S + + S S GG A IT P+ Sbjct 91 LTREHGIAQLDGRNRICKYESEDGTLQLGTAHSESAKRCSASDSDQGGAKIAKITEEPQI 150 Query 65 S 65 + Sbjct 151 T 151 Lambda K H 0.321 0.130 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1184494980 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40