bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_3629_orf5 Length=107 Score E Sequences producing significant alignments: (Bits) Value At1g33480 29.6 1.2 Hs20977541 29.6 1.6 7303912 29.3 1.6 > At1g33480 Length=508 Score = 29.6 bits (65), Expect = 1.2, Method: Composition-based stats. Identities = 9/21 (42%), Positives = 12/21 (57%), Gaps = 0/21 (0%) Query 67 NAGVRHRCCTCHISHFCCMHR 87 N G CC+C H+CC+ R Sbjct 248 NIGTSSACCSCRTVHYCCVSR 268 > Hs20977541 Length=1957 Score = 29.6 bits (65), Expect = 1.6, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 26/38 (68%), Gaps = 4/38 (10%) Query 13 RLQSITESTRHLRRRDSQYALLNCVLIRLTNGLDARRK 50 +LQ +T+S+R R+S+ + L+C LT+ LD+RR+ Sbjct 1656 KLQEVTKSSR----RNSEGSELSCTEGSLTSSLDSRRQ 1689 > 7303912 Length=630 Score = 29.3 bits (64), Expect = 1.6, Method: Composition-based stats. Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Query 3 KCTTCYLNTPRLQSITESTRHLRRRDSQYALLNCV 37 K +C ++ P LQS+ ES HL D LLNC+ Sbjct 452 KIVSCVID-PLLQSVQESAAHLPTVDMGVYLLNCL 485 Lambda K H 0.330 0.135 0.468 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1164169380 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40