bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_3629_orf4 Length=114 Score E Sequences producing significant alignments: (Bits) Value At1g04310 28.9 2.3 Hs18544513 28.5 2.8 > At1g04310 Length=645 Score = 28.9 bits (63), Expect = 2.3, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 5/54 (9%) Query 53 TRANQHIRVHLHVHLQTKIFTYLRLHVWMYSRVAIVGAYLHCENCLVAIPSHFR 106 T + H+R+ L TKI T L H +Y+ + + L +NC V IP+ + Sbjct 172 TETSLHVRM-----LTTKIRTSLDRHTILYTTLVELSKTLGLKNCAVWIPNEIK 220 > Hs18544513 Length=111 Score = 28.5 bits (62), Expect = 2.8, Method: Compositional matrix adjust. Identities = 14/52 (26%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Query 64 HVHLQTKIFTYLRLHVWMYSRV--AIVGAYLHCENCLVAIPSHFRIFQDIPV 113 V+L K T +++H++ YS+ +V H +C+ S F +D+P+ Sbjct 50 KVNLDLKGCTRVKMHIYKYSKADKEMVVEAAHTPSCVTLASSSFLTLRDVPL 101 Lambda K H 0.336 0.141 0.483 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1181971906 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40