bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_3628_orf3 Length=102 Score E Sequences producing significant alignments: (Bits) Value At1g35490 29.3 2.0 Hs18553507 28.1 4.2 SPAC19G12.15c 27.7 6.0 > At1g35490 Length=273 Score = 29.3 bits (64), Expect = 2.0, Method: Compositional matrix adjust. Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 0/22 (0%) Query 35 GSSTKPWGPRGPTEKKRFMEHN 56 G+STKP GPR T+ KR N Sbjct 131 GTSTKPDGPRSKTDSKRIKHQN 152 > Hs18553507 Length=93 Score = 28.1 bits (61), Expect = 4.2, Method: Compositional matrix adjust. Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 0/40 (0%) Query 18 LLLLLLLLVGGEAAALRGSSTKPWGPRGPTEKKRFMEHNG 57 L LL L L+ + R ++ +PW GP ++ +F NG Sbjct 31 LYLLHLALINPVVSWDRKNNPEPWNKLGPNDQYKFYSVNG 70 > SPAC19G12.15c Length=817 Score = 27.7 bits (60), Expect = 6.0, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 23/57 (40%), Gaps = 3/57 (5%) Query 49 KKRFMEHNGGALATHARKPRAAAAADAVAADAAAAAAAAKGPDWVRSCRQS---RAW 102 K+ FM G L R P AA + + + A AA K W+ S R R W Sbjct 564 KRLFMMDYDGTLTPIVRDPNAAVPSKKLLDNLATLAADPKNQVWIISGRDQQFLRNW 620 Lambda K H 0.318 0.130 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1181107380 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40