bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_3417_orf2 Length=96 Score E Sequences producing significant alignments: (Bits) Value At5g20960 30.4 0.79 Hs20548761 28.9 2.6 7301847 27.7 4.9 CE12826 27.7 5.9 CE20283 27.7 6.0 > At5g20960 Length=1368 Score = 30.4 bits (67), Expect = 0.79, Method: Composition-based stats. Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 5/43 (11%) Query 14 TTMPQRKFLLEILKGIRFMEQRWPGGYLGRSTPEVLPTGNTHL 56 +TMP L +KGIRF + R P G LG T + +P G ++ Sbjct 634 STMP-----LARIKGIRFKQNRVPEGVLGIITYKDIPKGGQNI 671 > Hs20548761 Length=923 Score = 28.9 bits (63), Expect = 2.6, Method: Compositional matrix adjust. Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 0/38 (0%) Query 40 YLGRSTPEVLPTGNTHLLWNPDAVFKGRGCRCGELPCR 77 YLG PE N HL W AVF + C +P R Sbjct 599 YLGVKIPESAKDMNVHLPWIRHAVFCYQTCMAEVIPSR 636 > 7301847 Length=631 Score = 27.7 bits (60), Expect = 4.9, Method: Composition-based stats. Identities = 12/24 (50%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Query 59 NPDAVFKGRGCRCGE--LPCRRDC 80 NP VF G +CGE LPC + C Sbjct 346 NPKCVFTEGGVKCGERTLPCCKHC 369 > CE12826 Length=1019 Score = 27.7 bits (60), Expect = 5.9, Method: Composition-based stats. Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 5/44 (11%) Query 11 SEETTMPQRKFLLEILKGIRFMEQRWPGGYLGRSTPEVLPTGNT 54 ++ +P+ L +IL G+ FM + LG +T ++LP G T Sbjct 645 NDNAILPRTTTLPDILIGLDFMSR-----ILGETTSKILPNGTT 683 > CE20283 Length=624 Score = 27.7 bits (60), Expect = 6.0, Method: Composition-based stats. Identities = 23/83 (27%), Positives = 31/83 (37%), Gaps = 20/83 (24%) Query 2 RQREKSGKSSEE------TTMPQRKFLLEILK--------------GIRFMEQRWPGGYL 41 + EKS E+ +P+ LL+ILK I + P G L Sbjct 518 KNEEKSEHEDEDREIFDAPKLPEPSKLLKILKTAQISVSMDPVEGTSITILAPNPPTGEL 577 Query 42 GRSTPEVLPTGNTHLLWNPDAVF 64 RS P +P G L+ P VF Sbjct 578 NRSQPMSIPGGRRQLIHRPQKVF 600 Lambda K H 0.321 0.139 0.444 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1201432980 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40