bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_3314_orf3 Length=148 Score E Sequences producing significant alignments: (Bits) Value SPBP23A10.14c 32.3 0.32 CE26710 30.0 1.7 > SPBP23A10.14c Length=533 Score = 32.3 bits (72), Expect = 0.32, Method: Composition-based stats. Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Query 86 APLLLPSSWRSSSSSTCCCCCSKYALLLALTDNEKLASVLFNITIGSSSNKCSSSSSPAA 145 +PLL PSS R +S + A+ +L+D L + + +I SS CS+ SSP Sbjct 354 SPLLSPSSHRKTSGNLSRTGSESSAV--SLSDTTNLNTPISDIPSPGSSTTCSNLSSPHI 411 Query 146 ARR 148 R+ Sbjct 412 KRK 414 > CE26710 Length=570 Score = 30.0 bits (66), Expect = 1.7, Method: Composition-based stats. Identities = 15/43 (34%), Positives = 27/43 (62%), Gaps = 0/43 (0%) Query 43 KSSDVLRLFVAAGHLVSAAAAFEGITIRILLLLLLLIAAPETA 85 KS++++++FVA+G+ +S F I R + LLL ++ TA Sbjct 396 KSNNIMQIFVASGYYLSRILYFLNILTRSICYLLLFLSLGITA 438 Lambda K H 0.324 0.131 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1821716300 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40