bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_3306_orf2 Length=111 Score E Sequences producing significant alignments: (Bits) Value CE23596 31.2 0.46 CE00211 27.3 7.9 > CE23596 Length=449 Score = 31.2 bits (69), Expect = 0.46, Method: Composition-based stats. Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 0/44 (0%) Query 66 PAPPDAVHLVKQVSKKRLIIFSFLLFISAASQSLNGLLISAPIS 109 P P A HL +R I+F FL+F A +Q+ + L++ P++ Sbjct 147 PTPTWANHLPVFRENRRTILFDFLIFRKAKNQNFHALVVFFPLN 190 > CE00211 Length=382 Score = 27.3 bits (59), Expect = 7.9, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 26/58 (44%), Gaps = 7/58 (12%) Query 44 PQAXXXXXXXXXGPLAPAACCQPAPPDAV-------HLVKQVSKKRLIIFSFLLFISA 94 P+ GP A QPAPP A L ++VS+K+ ++ +L FI + Sbjct 115 PKPRSRRSASFSGPRKSAKVAQPAPPAATMHQPPKSRLQQEVSEKKEKVYDWLPFIKS 172 Lambda K H 0.325 0.138 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1192473466 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40