bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_3298_orf1 Length=130 Score E Sequences producing significant alignments: (Bits) Value Hs9506659 30.0 1.1 At4g26470 28.9 2.4 At5g14770 28.1 4.4 At2g38250 27.7 5.1 Hs22050622 27.7 5.8 Hs21389581 26.9 9.5 > Hs9506659 Length=418 Score = 30.0 bits (66), Expect = 1.1, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Query 21 TPQMPV---HPRTHTTGSFQKYNPSMHATRT 48 TP PV H +HT +KYNP+ H T T Sbjct 128 TPSQPVNNHHAHSHTPVEKRKYNPTSHHTTT 158 > At4g26470 Length=248 Score = 28.9 bits (63), Expect = 2.4, Method: Compositional matrix adjust. Identities = 11/47 (23%), Positives = 24/47 (51%), Gaps = 0/47 (0%) Query 70 LRNCMRHLQCTYSAPTCTCVFDARISGSDLSVLASEFPFIYFIIYFI 116 L+NC+R L+ ++ +F A D+ + +EF + ++Y + Sbjct 79 LKNCIRKLEISFDEEEINDLFKACDINEDMGITFTEFIVLLCLVYLL 125 > At5g14770 Length=938 Score = 28.1 bits (61), Expect = 4.4, Method: Composition-based stats. Identities = 16/71 (22%), Positives = 32/71 (45%), Gaps = 4/71 (5%) Query 13 CAQTAGVRTPQMPVHPRTHTTGSFQKYNPSMHATRTR--EQLFRGIKATYLMLKSTWAAL 70 C + ++ PQ+P T + + ++++P + +TR LF + YL + + A Sbjct 19 CRSFSSIKRPQIPESEETSLSITQRRFDPDLAPIKTRVYVSLFHTLFRLYLSCERLYGAA 78 Query 71 RNCMRHLQCTY 81 R CT+ Sbjct 79 RTL--SAMCTF 87 > At2g38250 Length=289 Score = 27.7 bits (60), Expect = 5.1, Method: Compositional matrix adjust. Identities = 24/88 (27%), Positives = 29/88 (32%), Gaps = 14/88 (15%) Query 3 HTQSQTRTIKCAQTAGVRTPQMPVHPRTHTTGSFQKYNPSMHATRTREQLFRGIKATYLM 62 HTQSQT I G R PQ V G + + Q F K L+ Sbjct 21 HTQSQTPEIASPVAVGDRFPQWSVEETKELIGIRGELD----------QTFMETKRNKLL 70 Query 63 LKSTWAALRNCMRHLQCTYSAPTCTCVF 90 W + N MR S C C + Sbjct 71 ----WEVISNKMRDKSFPRSPEQCKCKW 94 > Hs22050622 Length=266 Score = 27.7 bits (60), Expect = 5.8, Method: Compositional matrix adjust. Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 0/38 (0%) Query 71 RNCMRHLQCTYSAPTCTCVFDARISGSDLSVLASEFPF 108 R C R+ C ++P + A+I+ SD +LA + PF Sbjct 219 RICKRNSACASTSPLHISILTAQINMSDAVILAGDRPF 256 > Hs21389581 Length=579 Score = 26.9 bits (58), Expect = 9.5, Method: Composition-based stats. Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 0/25 (0%) Query 80 TYSAPTCTCVFDARISGSDLSVLAS 104 TY A TC C F+ S D++VL S Sbjct 472 TYVADTCRCFFERGYSPKDVAVLVS 496 Lambda K H 0.331 0.137 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1246445644 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40