bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_3224_orf3 Length=130 Score E Sequences producing significant alignments: (Bits) Value Hs7662034 30.8 0.64 At1g33750 30.8 0.71 At5g56900 27.7 5.3 7291500 27.3 7.5 > Hs7662034 Length=907 Score = 30.8 bits (68), Expect = 0.64, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Query 76 VHRQHALRQLPVKRQRAFSGVWTPEQLPHHPRP 108 +H ++ +R LP +R +++ WTPE + H P P Sbjct 616 LHHKNTMRLLPTRR--SYTYWWTPEVIKHLPLP 646 > At1g33750 Length=603 Score = 30.8 bits (68), Expect = 0.71, Method: Composition-based stats. Identities = 32/99 (32%), Positives = 40/99 (40%), Gaps = 34/99 (34%) Query 22 RQVQQLGSGSR-PLQHLEPLCCFLHELQQQHVVL-RRVRQLHLRRVERCCVCCCSKVHRQ 79 + + LG+G+R PL+ L F L Q H L RR +L+L CV CSK Sbjct 11 KTLPHLGNGTRLPLK--TKLSLFPMHLLQNHTTLSRRSTKLNL------CVKACSKT--- 59 Query 80 HALRQLPVKRQRAFSGVWTPEQLPHHPRPLPHQLPDLFA 118 SGV RPLPH PDL+ Sbjct 60 --------------SGV-------ESSRPLPHSAPDLWG 77 > At5g56900 Length=593 Score = 27.7 bits (60), Expect = 5.3, Method: Compositional matrix adjust. Identities = 12/44 (27%), Positives = 19/44 (43%), Gaps = 0/44 (0%) Query 39 PLCCFLHELQQQHVVLRRVRQLHLRRVERCCVCCCSKVHRQHAL 82 P C + HE Q + + R+ R + R + C C S H + Sbjct 351 PECSYKHEFQDESSIQRKPRSENANRSKECWFCLSSPSVESHLI 394 > 7291500 Length=1439 Score = 27.3 bits (59), Expect = 7.5, Method: Composition-based stats. Identities = 14/47 (29%), Positives = 27/47 (57%), Gaps = 13/47 (27%) Query 30 GSRPLQHLEPLCCFLHELQQQHV----------VLRRVR---QLHLR 63 G +PLQ+++ +C FL+ ++ HV +++R+R Q+ LR Sbjct 1276 GPKPLQYMDQICDFLYHIKYIHVGNIIKNESEAIIKRLRPLLQMRLR 1322 Lambda K H 0.330 0.141 0.479 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1246445644 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40